Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PSMD8 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PSMD8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154588
|
Novus Biologicals
NBP154588 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
PSMD8 Polyclonal specifically detects PSMD8 in Human samples. It is validated for Western Blot.Specifications
| PSMD8 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| 26S proteasome non-ATPase regulatory subunit 8, 26S proteasome regulatory subunit p31, HIP6,26S proteasome regulatory subunit S14, HYPF, MGC1660, Nin1p, p3126S proteasome regulatory subunit RPN12, proteasome (prosome, macropain) 26S subunit, non-ATPase, 8, Rpn12, S14 | |
| PSMD8 | |
| IgG | |
| Affinity Purified | |
| This product is specific to Subunit or Isoform: 8. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 5714 | |
| Synthetic peptides corresponding to PSMD8(proteasome (prosome, macropain) 26S subunit, non-ATPase, 8) The peptide sequence was selected from the C terminal of PSMD8. Peptide sequence DYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. | |
| 27 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title