Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PSMG1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP152843

 View more versions of this product

Catalog No. NBP152843


Add to cart

Description

Description

PSMG1 Polyclonal antibody specifically detects PSMG1 in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

PSMG1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
PSMG1
Synthetic peptides corresponding to PSMG1(proteasome (prosome, macropain) assembly chaperone 1) The peptide sequence was selected from the middle region of PSMG1. Peptide sequence VMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT.
Immunogen affinity purified
RUO
Primary
8624
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:100 - 1:2000
O95456
C21-LRP, C21LRPc21-LRP, Chromosome 21 leucine-rich protein, Down syndrome critical region gene 2, DSCR2leucine rich protein C21-LRP, LRPC21, PAC-1, PAC1Down syndrome critical region protein 2, proteasome (prosome, macropain) assembly chaperone 1, proteasome assembling chaperone 1, proteasome assembly chaperone 1
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Rabbit: 100%; Equine: 92%; Mouse: 92%; Rat: 92%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit