PSMG3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179828

Catalog No. NBP179828

Description

PSMG3 Polyclonal specifically detects PSMG3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PSMG3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C7orf48, hPAC3, MGC10911, PAC-3, PAC3chromosome 7 open reading frame 48, proteasome (prosome, macropain) assembly chaperone 3, proteasome assembling chaperone 3, proteasome assembly chaperone 3
• Host Species: Rabbit
• Molecular Weight of Antigen: 13 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 86%; Horse: 85%; Bovine: 77% Chicken: 76%.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_115678
• Gene Symbols: PSMG3
• Immunogen: The immunogen for this antibody is PSMG3. Peptide sequence VLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84262
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.