Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PSMG3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17982820UL

 View more versions of this product

Catalog No. NBP17982820


Add to cart

Description

Description

PSMG3 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

PSMG3
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
PSMG3
The immunogen for this antibody is PSMG3. Peptide sequence VLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREV.
13 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:1000
NP_115678
C7orf48, hPAC3, MGC10911, PAC-3, PAC3chromosome 7 open reading frame 48, proteasome (prosome, macropain) assembly chaperone 3, proteasome assembling chaperone 3, proteasome assembly chaperone 3
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
84262
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit