Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PTPIP51 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16247420UL
Description
PTPIP51 Polyclonal specifically detects PTPIP51 in Human samples. It is validated for Western Blot.Specifications
PTPIP51 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q96TC7 | |
FAM82A2 | |
Synthetic peptides corresponding to PTPIP51 The peptide sequence was selected from the middle region of PTPIP51. Peptide sequence LSATVEDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLA. | |
Affinity Purified | |
RUO | |
55177 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Cerebral protein 10, FAM82Cmicrotubule-associated protein, family with sequence similarity 82, member A2, FLJ10579, hRMD-3, Protein FAM82A2, Protein FAM82C, Protein tyrosine phosphatase-interacting protein 51, ptpip51, PTPIP51family with sequence similarity 82, member C, regulator of microtubule dynamics 3, regulator of microtubule dynamics protein 3, RMD3, RMD-3, TCPTP-interacting protein 51 | |
Rabbit | |
52 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction