Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ PTPN20 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Supplier: Novus Biologicals™ NBP246761PEP
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTPN20 The PTPN20 Recombinant Protein Antigen is derived from E. coli. The PTPN20 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
MALELKNLPGEFNSGNQPSNREKNRYRDILP | |
PTPN20 | |
PBS and 1M Urea, pH 7.4 | |
protein tyrosine phosphatase, non-receptor type 20, bA42B19.1, protein tyrosine phosphatase, non-receptor type 20B | |
Unlabeled | |
Recombinant Protein Antigen | |
RUO | |
Human |
>80% by SDS-PAGE and Coomassie blue staining | |
Store at −20°C short term. Avoid freeze-thaw cycles. | |
AC | |
PTPN20 | |
21 kDa | |
0.1mL | |
E.coli |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only.
Spot an opportunity for improvement?
Provide Content Correction