Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PU.1/Spi-1 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180287

 View more versions of this product

Catalog No. NBP180287

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

PU.1/Spi-1 Polyclonal antibody specifically detects Antigen in Human, Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

PU.1/Spi-1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
SPI1
Synthetic peptide directed towards the N terminal of mouse SFPI1 (NP_035485). Peptide sequence NEFENFPENHFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHTGLSH.
30 kDa
100ul
Innate Immunity
Primary
6688
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 5 ug/ml
P17433
hematopoietic transcription factor PU.1, OF, PU.1, SFPI131 kDa transforming protein, SPI-1, SPI-1 proto-oncogene, SPI-A, spleen focus forming virus (SFFV) proviral integration oncogene spi1,31 kDa-transforming protein, transcription factor PU.1
Rabbit
IgG
Protein A purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Mouse: 100%.
Human, Mouse
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit