Learn More
Abnova™ Purified EDA (NP_001005609.1 245 a.a. - 389 a.a.) human Recombinant Protein with His-Flag-StrepII tag at N-terminus expressed in human cells (H04)
Used for ELISA, PI, SDS-PAGE, WB
Supplier: Abnova™ H00001896H04
Description
The protein encoded by this gene is a type II membrane protein that can be cleaved by furin to produce a secreted form. The encoded protein, which belongs to the tumor necrosis factor family, acts as a homotrimer and may be involved in cell-cell signaling during the development of ectodermal organs. Defects in this gene are a cause of ectodermal dysplasia, anhidrotic, which is also known as X-linked hypohidrotic ectodermal dysplasia. Several transcript variants encoding many different isoforms have been found for this gene. [provided by RefSeq]
Sequence: ENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPASSpecifications
NP_001005609.1 | |
ELISA, Protein Interaction, SDS-PAGE, Western Blot | |
1896 | |
EDA (Human) Recombinant Protein | |
Strep-Tactin affinity columns | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ED1/ED1-A1/ED1-A2/EDA1/EDA2/HED/XHED/XLHED | |
EDA | |
Human | |
His-Flag-StrepII | |
Liquid |
≥ 10 ug/ml | |
Liquid | |
21.23kDa | |
Transfection of pSuper-EDA plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column. | |
SDS-PAGE and Western Blot | |
ENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS | |
RUO | |
EDA | |
Not Tested | |
Recombinant | |
Transfection of pSuper-EDA plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column. |
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.