Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Purified EDA (NP_001390.1 245 a.a. - 391 a.a.) human Recombinant Protein with His-Flag-StrepII tag at N-terminus expressed in human cells

Used for ELISA, PI, SDS-PAGE, WB

Manufacturer:  Abnova™ H00001896H01

Catalog No. 89-942-737


Add to cart

Description

Description

The protein encoded by this gene is a type II membrane protein that can be cleaved by furin to produce a secreted form. The encoded protein, which belongs to the tumor necrosis factor family, acts as a homotrimer and may be involved in cell-cell signaling during the development of ectodermal organs. Defects in this gene are a cause of ectodermal dysplasia, anhidrotic, which is also known as X-linked hypohidrotic ectodermal dysplasia. Several transcript variants encoding many different isoforms have been found for this gene. [provided by RefSeq]

Sequence: ENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS
Specifications

Specifications

NP_001390.1
Enzyme-linked Immunoabsorbent Assay, Protein Interaction, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis, Western Blot
Liquid
21.45kDa
Transfection of pSuper-EDA plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
SDS-PAGE and Western Blot
ENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS
RUO
EDA
Transfection of pSuper-EDA plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
Human
His-Flag-StrepII
≥ 10 ug/ml
Liquid
1896
EDA (Human) Recombinant Protein
Strep-Tactin affinity columns
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ED1|ED1-A1|ED1-A2|EDA1|EDA2|HED|XHED|XLHED
EDA
Not Tested
Yes
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit