Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Purified ICOSLG (AAH64637.1 18 a.a. - 135 a.a.) human Recombinant Protein with His-Flag-StrepII tag at N-terminus expressed in human cells

Used for ELISA, PI, SDS-PAGE, WB

Manufacturer:  Abnova™ H00023308H02

Catalog No. 89-948-211

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

Sequence: ADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVA
Specifications

Specifications

AAH64637.1
≥ 10 ug/ml
Liquid
23308
ICOSLG (Human) Recombinant Protein
Strep-Tactin affinity columns
2 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
B7-H2|B7H2|B7RP-1|B7RP1|CD275|GL50|ICOS-L|ICOSL|KIAA0653|LICOS
ICOSLG
Human
His-Flag-StrepII
Transfection of pSuper-ICOSLG plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
Enzyme-linked Immunoabsorbent Assay, Protein Interaction, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis, Western Blot
Liquid
18.26kDa
Transfection of pSuper-ICOSLG plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
SDS-PAGE and Western Blot
ADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVA
RUO
ICOSLG
Not Tested
Yes
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit