Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PUS10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$464.00

Specifications

Antigen	PUS10
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP156369 View Documents View Product Certificates	Novus Biologicals NBP156369	100 μL	Each of 1 for $464.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

PUS10 Polyclonal specifically detects PUS10 in Human samples. It is validated for Western Blot.

Specifications

Antigen	PUS10
Classification	Polyclonal
Host Species	Rabbit
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias	CCDC139, coiled-coil domain containing 139, Coiled-coil domain-containing protein 139, DOBIMGC126729, EC 5.4.99, EC 5.4.99.-, FLJ32312, MGC126755, pseudouridine synthase 10, pseudouridylate synthase 10, Psi55 synthase, PUS1, putative tRNA pseudouridine synthase Pus10, tRNA pseudouridine 55 synthase, tRNA pseudouridylate synthase, tRNA-uridine isomerase
Gene Symbols	PUS10
Isotype	IgG
Purification Method	Affinity Purified

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q3MIT2
Gene ID (Entrez)	150962
Immunogen	Synthetic peptides corresponding to PUS10 (pseudouridylate synthase 10) The peptide sequence was selected from the middle region of PUS10. Peptide sequence AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN.
Primary or Secondary	Primary
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

PUS10 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents