Abnova™ Human PVRL4 Partial ORF (NP_112178, 31 a.a. - 139 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Manufacturer:  Abnova™ H00081607Q01S

Catalog No. 89-958-930

Description

Poliovirus receptor-like proteins (PVRLs), such as PVRL4, are adhesion receptors of the immunoglobulin superfamily and function in cell-cell adhesion (Reymond et al., 2001 [PubMed 11544254]).[supplied by OMIM]

Sequence: AGELGTSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQA

Specifications

• Accession Number: NP_112178
• Expression System: wheat germ expression system
• Format: Liquid
• Gene Alias: LNIR|PRR4|nectin-4
• Gene Symbol: PVRL4
• Immunogen: AGELGTSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQA
• Name: PVRL4 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Recombinant: Yes
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.

• Common Name: PVRL4
• For Use With (Application): Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 81607
• Host Species: Wheat Germ (in vitro)
• Molecular Weight: 37.73kDa
• Protein Tag: GST
• Quantity: 10 ug
• Regulatory Status: RUO