Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PWP2H Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP152844

 View more versions of this product

Catalog No. NBP152844


Add to cart

Description

Description

PWP2H Polyclonal antibody specifically detects PWP2H in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig samples. It is validated for Western Blot.
Specifications

Specifications

PWP2H
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
PWP2
Synthetic peptides corresponding to PWP2(PWP2 periodic tryptophan protein homolog (yeast)) The peptide sequence was selected from the middle region of PWP2. Peptide sequence VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM.
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Chicken: 85%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat
Western Blot
Western Blot 1:100-1:2000
Q15269
periodic tryptophan protein 2 homolog, PWP2 (periodic tryptophan protein, yeast) homolog, PWP2 periodic tryptophan protein homolog (yeast), PWP2HEHOC-17
Rabbit
IgG
100 ul
Stem Cell Markers
Primary
5822
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit