Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PWWP2A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen PWWP2A
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17064220
View Documents
Novus Biologicals
NBP17064220UL
20 μL
Each for $152.22
Add to cart
 
NBP170642
View Documents
Novus Biologicals
NBP170642
100 μL
Each for $436.00
Add to cart
 
Description

Description

PWWP2A Polyclonal specifically detects PWWP2A in Human samples. It is validated for Western Blot.
Specifications

Specifications

PWWP2A
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
114825
Synthetic peptides corresponding to PWWP2A(PWWP domain containing 2A) The peptide sequence was selected from the C terminal of PWWP2A. Peptide sequence PQSRCTSTRSAGLNKWQLLHQTVTSPAAPLQCLTDHCGFRLGALKLTVKR.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
KIAA1935, MST101, MSTP101, PWWP domain containing 2A, PWWP domain-containing protein 2A
PWWP2A
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit