PWWP2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155176

Catalog No. NBP155176

Description

PWWP2B Polyclonal specifically detects PWWP2B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PWWP2B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: PWWP2B
• Immunogen: Synthetic peptides corresponding to PWWP2B(PWWP domain containing 2B) The peptide sequence was selected from the N terminal of PWWP2B. Peptide sequence ILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQLGSSS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 170394
• Target Species: Human, Mouse, Rat, Pig, Bovine
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: bA432J24.1, FLJ39621, FLJ46823, pp8607, PWWP domain containing 2, PWWP domain containing 2B, PWWP domain-containing protein 2B, PWWP2, RP11-273H7.1
• Host Species: Rabbit
• Molecular Weight of Antigen: 53 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.