Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PWWP2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PWWP2B |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PWWP2B Polyclonal specifically detects PWWP2B in Human samples. It is validated for Western Blot.Specifications
PWWP2B | |
Polyclonal | |
Rabbit | |
bA432J24.1, FLJ39621, FLJ46823, pp8607, PWWP domain containing 2, PWWP domain containing 2B, PWWP domain-containing protein 2B, PWWP2, RP11-273H7.1 | |
PWWP2B | |
IgG | |
53 kDa |
Western Blot | |
Unconjugated | |
RUO | |
170394 | |
Synthetic peptides corresponding to PWWP2B(PWWP domain containing 2B) The peptide sequence was selected from the N terminal of PWWP2B. Peptide sequence ILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQLGSSS. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title