Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PX19 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen PX19
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125222
View Documents
Novus Biologicals
NBP31016025UL
25 μg
Each for $106.19
Add to cart
 
NB125221
View Documents
Novus Biologicals
NBP310160100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

PX19 Polyclonal antibody specifically detects PX19 in Mouse samples. It is validated for Western Blot
Specifications

Specifications

PX19
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
27166
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Mouse
25 kDa protein of relevant evolutionary and lymphoid interest, CGI-106, MGC87972, PRELI domain containing 1, PRELImitochondrial, protein of relevant evolutionary and lymphoid interest
The immunogen is a synthetic peptide directed towards the N terminal region of mouse PX19 (NP_079872.4). Peptide sequence QSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLSRRLLT
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit