Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
QPCTL Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | QPCTL |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16258620
|
Novus Biologicals
NBP16258620UL |
20 μL |
Each for $152.22
|
|
NBP162586
|
Novus Biologicals
NBP162586 |
100 μL |
Each for $436.00
|
|
Description
QPCTL Polyclonal specifically detects QPCTL in Human samples. It is validated for Western Blot.Specifications
| QPCTL | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 2.3.2, EC 2.3.2.5, FLJ20084, glutaminyl cyclase-like, glutaminyl-peptide cyclotransferase-like, glutaminyl-peptide cyclotransferase-like protein, Golgi-resident glutaminyl-peptide cyclotransferase, gQC, isoQC | |
| QPCTL | |
| IgG | |
| Affinity Purified | |
| 43 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9NXS2 | |
| 54814 | |
| Synthetic peptides corresponding to QPCTL(glutaminyl-peptide cyclotransferase-like) The peptide sequence was selected from the middle region of QPCTL. Peptide sequence QLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFML. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title