Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

QPCTL Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen QPCTL
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16258620
View Documents
Novus Biologicals
NBP16258620UL
20 μL
Each for $152.22
Add to cart
 
NBP162586
View Documents
Novus Biologicals
NBP162586
100 μL
Each for $436.00
Add to cart
 
Description

Description

QPCTL Polyclonal specifically detects QPCTL in Human samples. It is validated for Western Blot.
Specifications

Specifications

QPCTL
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
EC 2.3.2, EC 2.3.2.5, FLJ20084, glutaminyl cyclase-like, glutaminyl-peptide cyclotransferase-like, glutaminyl-peptide cyclotransferase-like protein, Golgi-resident glutaminyl-peptide cyclotransferase, gQC, isoQC
QPCTL
IgG
Affinity Purified
43 kDa
Western Blot
Unconjugated
RUO
Q9NXS2
54814
Synthetic peptides corresponding to QPCTL(glutaminyl-peptide cyclotransferase-like) The peptide sequence was selected from the middle region of QPCTL. Peptide sequence QLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFML.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit