Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
QTRTD1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Novus Biologicals NBP30926425UL
Description
QTRTD1 Polyclonal specifically detects QTRTD1 in Mouse samples. It is validated for Western Blot.Specifications
QTRTD1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
EC 2.4.2.29, FLJ12960, queuine tRNA-ribosyltransferase domain containing 1, Queuine tRNA-ribosyltransferase domain-containing protein 1, queuine tRNA-ribosyltransferase subunit QTRTD1 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Qtrtd1 (NP_083404). Peptide sequence EVLECIERGVDLFESFFPYQVTERGCALTFTFDCQLNPEETLLQQNGIQE | |
25 μg | |
Primary | |
Mouse |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
79691 | |
Purified |
Safety and Handling
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title