Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

QTRTD1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP30926425UL

 View more versions of this product

Catalog No. NB123430

Add to cart



QTRTD1 Polyclonal specifically detects QTRTD1 in Mouse samples. It is validated for Western Blot.


Western Blot 1.0 ug/ml
EC, FLJ12960, queuine tRNA-ribosyltransferase domain containing 1, Queuine tRNA-ribosyltransferase domain-containing protein 1, queuine tRNA-ribosyltransferase subunit QTRTD1
The immunogen is a synthetic peptide directed towards the C-terminal region of Qtrtd1 (NP_083404). Peptide sequence EVLECIERGVDLFESFFPYQVTERGCALTFTFDCQLNPEETLLQQNGIQE
25 μg
Western Blot
PBS buffer, 2% sucrose
Affinity purified
Safety and Handling

Safety and Handling

Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit