Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RAB23 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17964720UL

 View more versions of this product

Catalog No. NBP17964720


Add to cart

Description

Description

RAB23 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

RAB23
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
RAB23
Synthetic peptide directed towards the middle region of human Rab23The immunogen for this antibody is Rab23. Peptide sequence DPEQTHSSSNKIGVFNASVRSHLGQNSSSLNGGDVINLRPNKQRTKRTRN.
26 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Mouse
Western Blot
Western Blot 1:1000
NP_033025
DKFZp781H0695, HSPC137, MGC8900, RAB family small GTP binding protein RAB 23, RAB23, member RAS oncogene family, ras-related protein Rab-23
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
51715
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit