Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB27B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP179631
Description
RAB27B Polyclonal specifically detects RAB27B in Human, Mouse samples. It is validated for Western Blot.Specifications
RAB27B | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
C25KG, RAB27B, member RAS oncogene family, ras-related protein Rab-27B | |
Rabbit | |
24 kDa | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Zebrafish: 79%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_085031 | |
RAB27B | |
The immunogen for this antibody is Rab27b. Peptide sequence YCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVE. | |
Affinity purified | |
RUO | |
5874 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction