Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB31 Rabbit anti-Human, Monkey, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | RAB31 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179921
|
Novus Biologicals
NBP179921 |
100 μL |
Each of 1 for $436.00
|
|
Description
RAB31 Polyclonal specifically detects RAB31 in Human samples. It is validated for Western Blot.Specifications
RAB31 | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
NP_006859 | |
11031 | |
The immunogen for this antibody is RAB31. Peptide sequence EVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGN. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Rab22B, RAB31, member RAS oncogene family, Ras-related protein Rab-22B, ras-related protein Rab-31 | |
RAB31 | |
IgG | |
Affinity Purified | |
21 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title