Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB38 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP158930
Description
RAB38 Polyclonal specifically detects RAB38 in Human samples. It is validated for Western Blot.Specifications
RAB38 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
P57729 | |
RAB38 | |
Synthetic peptides corresponding to RAB38(RAB38, member RAS oncogene family) The peptide sequence was selected from the N terminal of RAB38. Peptide sequence MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKV. | |
100 μL | |
Signal Transduction | |
23682 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with 0.09% Sodium Azide | |
Melanoma antigen NY-MEL-1, NY-MEL-1, RAB38, member RAS oncogene family, Rab-related GTP-binding protein, ras-related protein Rab-38, rrGTPbp | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Chicken: 92%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title