Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB38 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15893020UL
Description
RAB38 Polyclonal specifically detects RAB38 in Human samples. It is validated for Western Blot.Specifications
RAB38 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
P57729 | |
RAB38 | |
Synthetic peptides corresponding to RAB38(RAB38, member RAS oncogene family) The peptide sequence was selected from the N terminal of RAB38. Peptide sequence MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKV. | |
20 μL | |
Signal Transduction | |
23682 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
Melanoma antigen NY-MEL-1, NY-MEL-1, RAB38, member RAS oncogene family, Rab-related GTP-binding protein, ras-related protein Rab-38, rrGTPbp | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction