Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB39B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | RAB39B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP158900
|
Novus Biologicals
NBP158900 |
100 μL |
Each for $436.00
|
|
NBP15890020
|
Novus Biologicals
NBP15890020UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
RAB39B Polyclonal specifically detects RAB39B in Human samples. It is validated for Western Blot.Specifications
| RAB39B | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| Q96DA2 | |
| 116442 | |
| Synthetic peptides corresponding to RAB39B(RAB39B, member RAS oncogene family) The peptide sequence was selected from the N terminal of RAB39B. Peptide sequence MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| MRX72, RAB39B, member RAS oncogene family, ras-related protein Rab-39B | |
| RAB39B | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title