Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RAB39B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen RAB39B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP158900
View Documents
Novus Biologicals
NBP158900
100 μL
Each for $436.00
Add to cart
 
NBP15890020
View Documents
Novus Biologicals
NBP15890020UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

RAB39B Polyclonal specifically detects RAB39B in Human samples. It is validated for Western Blot.
Specifications

Specifications

RAB39B
Polyclonal
Rabbit
Signal Transduction
Q96DA2
116442
Synthetic peptides corresponding to RAB39B(RAB39B, member RAS oncogene family) The peptide sequence was selected from the N terminal of RAB39B. Peptide sequence MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
MRX72, RAB39B, member RAS oncogene family, ras-related protein Rab-39B
RAB39B
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit