Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB3IL1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | RAB3IL1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155343
|
Novus Biologicals
NBP155343 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
RAB3IL1 Polyclonal specifically detects RAB3IL1 in Human samples. It is validated for Western Blot.Specifications
| RAB3IL1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| GRAB, guanine nucleotide exchange factor for Rab3A, guanine nucleotide exchange factor for Rab-3A, RAB3A interacting protein (rabin3)-like 1, Rab-3A-interacting-like protein 1, Rab3A-interacting-like protein 1, Rabin3-like 1 | |
| RAB3IL1 | |
| IgG | |
| Affinity Purified | |
| 43 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8TBN0 | |
| 5866 | |
| Synthetic peptides corresponding to RAB3IL1(RAB3A interacting protein (rabin3)-like 1) The peptide sequence was selected from the middle region of RAB3IL1. Peptide sequence ARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title