Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RAB3IL1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen RAB3IL1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155343
View Documents
Novus Biologicals
NBP155343
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

RAB3IL1 Polyclonal specifically detects RAB3IL1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

RAB3IL1
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
GRAB, guanine nucleotide exchange factor for Rab3A, guanine nucleotide exchange factor for Rab-3A, RAB3A interacting protein (rabin3)-like 1, Rab-3A-interacting-like protein 1, Rab3A-interacting-like protein 1, Rabin3-like 1
RAB3IL1
IgG
Affinity Purified
43 kDa
Western Blot
Unconjugated
RUO
Q8TBN0
5866
Synthetic peptides corresponding to RAB3IL1(RAB3A interacting protein (rabin3)-like 1) The peptide sequence was selected from the middle region of RAB3IL1. Peptide sequence ARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRH.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit