Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB43 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Specifications
Antigen | RAB43 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB123929
|
Novus Biologicals
NBP309514100UL |
100 μg |
Each of 1 for $482.50
|
N/A | |||||
Description
RAB43 Polyclonal specifically detects RAB43 in Human samples. It is validated for Western Blot.Specifications
RAB43 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Signal Transduction | |
PBS buffer, 2% sucrose | |
339122 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
MGC90481, RAB11B, RAB41ISY1, RAB43, member RAS oncogene family, Ras-related protein Rab-41, ras-related protein Rab-43 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB43 (NP_940892.1). Peptide sequence ETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWG | |
Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title