Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB5C Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | RAB5C |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17418220
|
Novus Biologicals
NBP17418220UL |
20 μL |
Each for $152.22
|
|
NBP174182
|
Novus Biologicals
NBP174182 |
100 μL |
Each for $436.00
|
|
Description
RAB5C Polyclonal specifically detects RAB5C in Mouse samples. It is validated for Western Blot.Specifications
| RAB5C | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| L1880, MGC117217, RAB5C, member of RAS oncogene family, RAB5C, member RAS oncogene family, RAB5CL, RAB5L, RABLMGC138857, ras-related protein Rab-5C | |
| RAB5C | |
| IgG | |
| Affinity Purified | |
| 26 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8C266 | |
| 5878 | |
| Synthetic peptides corresponding to the C terminal of Rab5c. Immunizing peptide sequence FARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title