Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB6B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31000825UL
Description
RAB6B Polyclonal specifically detects RAB6B in Human samples. It is validated for Western Blot.Specifications
RAB6B | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
RAB6B, member RAS oncogene family, ras-related protein Rab-6B, small GTPase RAB6B, small GTP-binding protein | |
The immunogen is a synthetic peptide directed towards the C terminal region of human RAB6B (NP_057661.3). Peptide sequence ETSAKTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASE | |
25 μg | |
Signal Transduction | |
51560 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction