Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB8B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | RAB8B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16897420
|
Novus Biologicals
NBP16897420UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP168974
|
Novus Biologicals
NBP168974 |
100 μL |
Each for $482.50
|
|
|||||
Description
RAB8B Polyclonal specifically detects RAB8B in Human samples. It is validated for Western Blot.Specifications
| RAB8B | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| FLJ38125, RAB-8b protein, RAB8B, member RAS oncogene family, ras-related protein Rab-8B | |
| RAB8B | |
| IgG | |
| 78 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q92930 | |
| 51762 | |
| Synthetic peptides corresponding to RAB8B (RAB8B, member RAS oncogene family) The peptide sequence was selected from the C terminal of RAB8B. Peptide sequence RNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAK. | |
| Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title