Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB8B Rabbit anti-Human, Monkey, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16909520UL
Description
RAB8B Polyclonal specifically detects RAB8B in Human, Mouse, Monkey samples. It is validated for Western Blot.Specifications
RAB8B | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
FLJ38125, RAB-8b protein, RAB8B, member RAS oncogene family, ras-related protein Rab-8B | |
Rabbit | |
23 kDa | |
20 μL | |
Signal Transduction | |
51762 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
RAB8B | |
Synthetic peptides corresponding to RAB8B (RAB8B, member RAS oncogene family) The peptide sequence was selected from the C terminal of RAB8B. Peptide sequence SAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTS. | |
Affinity Purified | |
RUO | |
Primary | |
Human, Monkey | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title