RAB8B Rabbit anti-Human, Monkey, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169095

Catalog No. NBP169095

Description

RAB8B Polyclonal specifically detects RAB8B in Human, Mouse, Monkey samples. It is validated for Western Blot.

Specifications

• Antigen: RAB8B
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: FLJ38125, RAB-8b protein, RAB8B, member RAS oncogene family, ras-related protein Rab-8B
• Host Species: Rabbit
• Molecular Weight of Antigen: 23 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 51762
• Target Species: Human, Mouse, Monkey, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: RAB8B
• Immunogen: Synthetic peptides corresponding to RAB8B (RAB8B, member RAS oncogene family) The peptide sequence was selected from the C terminal of RAB8B. Peptide sequence SAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTS.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.