Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB8B Rabbit anti-Human, Monkey, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | RAB8B |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP16909520
|
Novus Biologicals
NBP16909520UL |
20 μL |
Each for $152.22
|
|
NBP169095
|
Novus Biologicals
NBP169095 |
100 μL |
Each for $436.00
|
|
Description
RAB8B Polyclonal specifically detects RAB8B in Human, Mouse, Monkey samples. It is validated for Western Blot.Specifications
RAB8B | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
FLJ38125, RAB-8b protein, RAB8B, member RAS oncogene family, ras-related protein Rab-8B | |
RAB8B | |
IgG | |
Affinity Purified | |
23 kDa |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
51762 | |
Synthetic peptides corresponding to RAB8B (RAB8B, member RAS oncogene family) The peptide sequence was selected from the C terminal of RAB8B. Peptide sequence SAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTS. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title