Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RAB9B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17965020UL

 View more versions of this product

Catalog No. NBP17965020


Add to cart

Description

Description

RAB9B Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

RAB9B
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
RAB9B
Synthetic peptide directed towards the N terminal of human RAB9BThe immunogen for this antibody is RAB9B. Peptide sequence KSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERF.
23 kDa
20ul
Signal Transduction
Primary
51209
Western Blot
Western Blot 1:1000
NP_057454
RAB9B, member RAS oncogene family, Rab-9L, RAB9-like protein, RAB9LRab-9-like protein, ras-related protein Rab-9B
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit