Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB9B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17965020UL
Description
RAB9B Polyclonal specifically detects RAB9B in Human samples. It is validated for Western Blot.Specifications
RAB9B | |
Polyclonal | |
Western Blot 1:1000 | |
NP_057454 | |
RAB9B | |
Synthetic peptide directed towards the N terminal of human RAB9BThe immunogen for this antibody is RAB9B. Peptide sequence KSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERF. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
RAB9B, member RAS oncogene family, Rab-9L, RAB9-like protein, RAB9LRab-9-like protein, ras-related protein Rab-9B | |
Rabbit | |
23 kDa | |
20 μL | |
Signal Transduction | |
51209 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction