Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RAB9B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen RAB9B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17965020
View Documents
Novus Biologicals
NBP17965020UL
20 μL
Each for $152.22
Add to cart
 
NBP179650
View Documents
Novus Biologicals
NBP179650
100 μL
Each for $436.00
Add to cart
 
Description

Description

RAB9B Polyclonal specifically detects RAB9B in Human samples. It is validated for Western Blot.
Specifications

Specifications

RAB9B
Polyclonal
Rabbit
Signal Transduction
NP_057454
51209
Synthetic peptide directed towards the N terminal of human RAB9BThe immunogen for this antibody is RAB9B. Peptide sequence KSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERF.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
RAB9B, member RAS oncogene family, Rab-9L, RAB9-like protein, RAB9LRab-9-like protein, ras-related protein Rab-9B
RAB9B
IgG
Affinity Purified
23 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit