Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB9B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | RAB9B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17965020
|
Novus Biologicals
NBP17965020UL |
20 μL |
Each for $152.22
|
|
NBP179650
|
Novus Biologicals
NBP179650 |
100 μL |
Each for $436.00
|
|
Description
RAB9B Polyclonal specifically detects RAB9B in Human samples. It is validated for Western Blot.Specifications
| RAB9B | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| NP_057454 | |
| 51209 | |
| Synthetic peptide directed towards the N terminal of human RAB9BThe immunogen for this antibody is RAB9B. Peptide sequence KSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| RAB9B, member RAS oncogene family, Rab-9L, RAB9-like protein, RAB9LRab-9-like protein, ras-related protein Rab-9B | |
| RAB9B | |
| IgG | |
| Affinity Purified | |
| 23 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title