Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ANKRD27 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant ANKRD27.

Manufacturer:  Abnova Corporation PAB23977

Catalog No. 89-125-681


Add to cart

Description

Description

Sequence: MALYDEDLLKNPFYLALQKCRPDLCSKVAQIHGIVLVPCKGSLSSSIQSTCQFESYILIPVEEHFQTLNGKDVFIQGNRIKLGAGFACLLSVPILFEETFYNEKEESFSILCI
Specifications

Specifications

ANKRD27
Unconjugated
Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
ANKRD27
Liquid
ANKRD27
Recombinant protein corresponding to amino acids of human ANKRD27.
Antigen affinity purification
RUO
Primary
84079
Immunohistochemistry (PFA fixed)
Rabbit polyclonal antibody raised against recombinant ANKRD27.
In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Q96NW4
DKFZp434L0718|FLJ00040|PP12899|VARP
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only