CHMP4B, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant CHMP4B.

Supplier:  Abnova Corporation PAB27902

Catalog No. 89-129-424

Description

CHMP4B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM

Sequence: SVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKK

Specifications

• Antigen: CHMP4B
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant CHMP4B.
• Formulation: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
• Gene Alias: C20orf178/CHMP4A/CTPP3/SNF7/SNF7-2/Shax1/dJ553F4.4
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 128866
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry, Western Blot, Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
• Gene: CHMP4B
• Gene Symbols: CHMP4B
• Immunogen: Recombinant protein corresponding to amino acids of human CHMP4B.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only