Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CLEC4C, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant CLEC4C.

Manufacturer:  Abnova Corporation PAB22289

Catalog No. 89-123-995


Add to cart

Description

Description

This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may play a role in dendritic cell function. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq

Sequence: MYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWN
Specifications

Specifications

CLEC4C
Unconjugated
Immunohistochemistry (1:20-1:50) The optimal working dilution should be determined by the end user.
CLEC4C
Liquid
CLEC4C
Recombinant protein corresponding to amino acids of human CLEC4C.
Antigen affinity purification
RUO
Primary
170482
Immunohistochemistry (PFA fixed)
Rabbit polyclonal antibody raised against recombinant CLEC4C.
In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Q8WTT0
BDCA2|CD303|CLECSF11|CLECSF7|DLEC|HECL|MGC125789|MGC125791|MGC125792|MGC125793|PRO34150
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only