eRF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238350

Catalog No. NBP238350

Description

eRF1 Polyclonal specifically detects eRF1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: eRF1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P62495
• Gene Symbols: ETF1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEF
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: D5S1995, ERF1eRF1, eukaryotic peptide chain release factor subunit 1, Eukaryotic release factor 1, eukaryotic translation termination factor 1, polypeptide chain release factor 1, Protein Cl1, RF1ERF, sup45 (yeast omnipotent suppressor 45) homolog-like 1, SUP45L1, TB3-1MGC111066
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2107
• Target Species: Human
• Isotype: IgG