Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FLJ20674, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant FLJ20674.

Manufacturer:  Abnova Corporation PAB20737

Catalog No. 89-122-237

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

Sequence: NLQGNYTCLALNQLSKRHRKVTTELLVYYPPPSAPQCWAQMASGSFMLQLTCRWDGGYPDPDFLWIEEPGGVIVGKSKLGVEMLSESQLSDGKKFKCVTSHIVGPESGASCMVQIRGPSLLSEPMKT
Specifications

Specifications

FLJ20674
Unconjugated
In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Q8N0Z9
MGC1013
Rabbit
IgG
100μL
Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Immunohistochemistry (Paraffin)
hypothetical protein FLJ20674
FLJ20674
Affinity Purified
FLJ20674
Recombinant protein corresponding to amino acids of human FLJ20674.
Antigen affinity purification
RUO
Primary
54621
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only