Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LARGE, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant LARGE.

Manufacturer:  Abnova Corporation PAB22223

Catalog No. 89-123-928

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

This gene, which is one of the largest in the human genome, encodes a member of the N-acetylglucosaminyltransferase gene family. It encodes a glycosyltransferase which participates in glycosylation of alpha-dystroglycan, and may carry out the synthesis of glycoprotein and glycosphingolipid sugar chains. It may also be involved in the addition of a repeated disaccharide unit. Mutations in this gene cause MDC1D, a novel form of congenital muscular dystrophy with severe mental retardation and abnormal glycosylation of alpha-dystroglycan. Alternative splicing of this gene results in two transcript variants that encode the same protein. [provided by RefSeq

Sequence: SFPKSKAELLSMLDMGTLFTFRYHVWTKGHAPTNFAKWRTATTPYRVEWEADFEPYVVVRRDCPEYDRRFVGFGWNKVAHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKEEFQQDMSRRYGFAALKY
Specifications

Specifications

LARGE
Unconjugated
In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Affinity Purified
LARGE
Recombinant protein corresponding to amino acids of human LARGE.
Antigen affinity purification
RUO
Primary
9215
Immunohistochemistry
like-glycosyltransferase
LARGE
KIAA0609, MDC1D
Rabbit
IgG
100μL
Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only