Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SYF2, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant SYF2

Supplier:  Abnova Corporation PAB28017

Catalog No. 89-129-533


Add to Cart

Description

Description

This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: AAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAARG
Specifications

Specifications

SYF2
Polyclonal
Rabbit polyclonal antibody raised against recombinant SYF2
In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
CBPIN/DKFZp564O2082/NTC31/P29/fSAP29
Rabbit
Antigen affinity purification
RUO
25949
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
IgG
Immunohistochemistry (PFA fixed), Western Blot
Unconjugated
Immunohistochemistry (1:500 - 1:1000) Western Blot (1:100 - 1:250) The optimal working dilution should be determined by the end user.
SYF2
SYF2
Recombinant protein corresponding to amino acids of human SYF2
100 μL
Primary
Human
Liquid
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only