SYF2, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant SYF2

Supplier:  Abnova Corporation PAB28017

Catalog No. 89-129-533

Description

This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: AAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAARG

Specifications

• Antigen: SYF2
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant SYF2
• Formulation: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
• Gene Alias: CBPIN/DKFZp564O2082/NTC31/P29/fSAP29
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 25949
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:500 - 1:1000) Western Blot (1:100 - 1:250) The optimal working dilution should be determined by the end user.
• Gene: SYF2
• Gene Symbols: SYF2
• Immunogen: Recombinant protein corresponding to amino acids of human SYF2
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only