Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TFPI2 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant TFPI2.

Manufacturer:  Abnova Corporation PAB18936

Catalog No. 89-120-489

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

Sequence: GAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV
Specifications

Specifications

TFPI2
Unconjugated
ELISA (1:300) Western Blot (1:500) The optimal working dilution should be determined by the end user.
TFPI2
FLJ21164|PP5|REF1|TFPI-2
Rabbit
Protein G purification
RUO
Primary
7980
ELISA, Western Blot
Rabbit polyclonal antibody raised against recombinant TFPI2.
Lyophilized from PBS
Lyophilized
TFPI2
Recombinant protein corresponding to human TFPI2.
100 ug
Store at -20°C on dry atmosphere. After reconstitution with 100μL distilled water
Polyclonal
Human
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only