Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RABL4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15892820UL
Description
RABL4 Polyclonal specifically detects RABL4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
RABL4 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence | |
Q9BW83-2 | |
IFT27 | |
Synthetic peptides corresponding to RABL4(RAB, member of RAS oncogene family-like 4) The peptide sequence was selected from the C terminal of RABL4. Peptide sequence RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA. | |
20 μL | |
Signal Transduction | |
11020 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
intraflagellar transport 27 homolog (Chlamydomonas), intraflagellar transport protein 27 homolog, member of RAS oncogene family-like 4, Putative GTP-binding protein RAY-like, RABL4, Rab-like protein 4 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction