Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RABL4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen RABL4
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
Regulatory Status RUO
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15892820
View Documents
Novus Biologicals
NBP15892820UL
20 μL
Each for $152.22
Add to cart
 
NBP158928
View Documents
Novus Biologicals
NBP158928
100 μL
Each for $436.00
Add to cart
 
Description

Description

RABL4 Polyclonal specifically detects RABL4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

RABL4
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
intraflagellar transport 27 homolog (Chlamydomonas), intraflagellar transport protein 27 homolog, member of RAS oncogene family-like 4, Putative GTP-binding protein RAY-like, RABL4, Rab-like protein 4
IFT27
IgG
Affinity Purified
Polyclonal
Rabbit
Signal Transduction
Q9BW83-2
11020
Synthetic peptides corresponding to RABL4(RAB, member of RAS oncogene family-like 4) The peptide sequence was selected from the C terminal of RABL4. Peptide sequence RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit