Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RABL4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | RABL4 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15892820
|
Novus Biologicals
NBP15892820UL |
20 μL |
Each for $152.22
|
|
NBP158928
|
Novus Biologicals
NBP158928 |
100 μL |
Each for $436.00
|
|
Description
RABL4 Polyclonal specifically detects RABL4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| RABL4 | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| intraflagellar transport 27 homolog (Chlamydomonas), intraflagellar transport protein 27 homolog, member of RAS oncogene family-like 4, Putative GTP-binding protein RAY-like, RABL4, Rab-like protein 4 | |
| IFT27 | |
| IgG | |
| Affinity Purified |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| Q9BW83-2 | |
| 11020 | |
| Synthetic peptides corresponding to RABL4(RAB, member of RAS oncogene family-like 4) The peptide sequence was selected from the C terminal of RABL4. Peptide sequence RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title