Rabphilin 3A Rabbit anti-Mouse, Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169184

Catalog No. NBP169184

Description

Rabphilin 3A Polyclonal specifically detects Rabphilin 3A in Mouse, Rat samples. It is validated for Western Blot.

Specifications

• Antigen: Rabphilin 3A
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P47708
• Gene Symbols: RPH3A
• Immunogen: Synthetic peptides corresponding to Rph3a (rabphilin 3A) The peptide sequence was selected from the N terminal of Rph3a. Peptide sequence GAWFFKGFPKQVLPQPMPIKKTKPQQPAGEPATQEQPTPESRHPARAPAR.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 22895
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Exophilin-1, KIAA0985exophilin-1, rabphilin, rabphilin 3A homolog (mouse), rabphilin-3A
• Host Species: Rabbit
• Molecular Weight of Antigen: 75 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Pig: 85%;.
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG