Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Rabphilin 3A Rabbit anti-Mouse, Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $329.00
Specifications
| Antigen | Rabphilin 3A |
|---|---|
| Immunogen | Synthetic peptides corresponding to Rph3a (rabphilin 3A) The peptide sequence was selected from the N terminal of Rph3a. Peptide sequence GAWFFKGFPKQVLPQPMPIKKTKPQQPAGEPATQEQPTPESRHPARAPAR. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP16918420 |
Novus Biologicals
NBP16918420UL |
20ul |
Each for $149.00
|
|
NBP169184 |
Novus Biologicals
NBP169184 |
100 ul |
Each for $329.00
|
|
Description
Rabphilin 3A Polyclonal antibody specifically detects Antigen in Mouse, Rat samples. It is validated for Western Blotting.Specifications
| Rabphilin 3A | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 22895 | |
| Affinity Purified | |
| Western Blot | |
| RUO |
| Synthetic peptides corresponding to Rph3a (rabphilin 3A) The peptide sequence was selected from the N terminal of Rph3a. Peptide sequence GAWFFKGFPKQVLPQPMPIKKTKPQQPAGEPATQEQPTPESRHPARAPAR. | |
| Primary | |
| IgG | |
| Exophilin-1, KIAA0985exophilin-1, rabphilin, rabphilin 3A homolog (mouse), rabphilin-3A | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title