Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Rabphilin 3A Rabbit anti-Mouse, Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody



Antigen Rabphilin 3A
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
100 μL
Each of 1 for $436.00
Add to cart


Rabphilin 3A Polyclonal specifically detects Rabphilin 3A in Mouse, Rat samples. It is validated for Western Blot.


Rabphilin 3A
PBS and 2% Sucrose with 0.09% Sodium Azide
Exophilin-1, KIAA0985exophilin-1, rabphilin, rabphilin 3A homolog (mouse), rabphilin-3A
Affinity Purified
75 kDa
Western Blot
Synthetic peptides corresponding to Rph3a (rabphilin 3A) The peptide sequence was selected from the N terminal of Rph3a. Peptide sequence GAWFFKGFPKQVLPQPMPIKKTKPQQPAGEPATQEQPTPESRHPARAPAR.
Store at -20C. Avoid freeze-thaw cycles.
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit