Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Rabphilin 3A Rabbit anti-Mouse, Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | Rabphilin 3A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP169184
|
Novus Biologicals
NBP169184 |
100 μL |
Each of 1 for $436.00
|
|
Description
Rabphilin 3A Polyclonal specifically detects Rabphilin 3A in Mouse, Rat samples. It is validated for Western Blot.Specifications
Rabphilin 3A | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Exophilin-1, KIAA0985exophilin-1, rabphilin, rabphilin 3A homolog (mouse), rabphilin-3A | |
RPH3A | |
IgG | |
Affinity Purified | |
75 kDa |
Western Blot | |
Unconjugated | |
RUO | |
P47708 | |
22895 | |
Synthetic peptides corresponding to Rph3a (rabphilin 3A) The peptide sequence was selected from the N terminal of Rph3a. Peptide sequence GAWFFKGFPKQVLPQPMPIKKTKPQQPAGEPATQEQPTPESRHPARAPAR. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title