Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAD9B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | RAD9B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP158205
|
Novus Biologicals
NBP158205 |
100 μL |
Each for $436.00
|
|
NBP15820520
|
Novus Biologicals
NBP15820520UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
RAD9B Polyclonal specifically detects RAD9B in Human samples. It is validated for Western Blot.Specifications
| RAD9B | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| Q6WBX8-3 | |
| 144715 | |
| Synthetic peptides corresponding to RAD9B(RAD9 homolog B (S. cerevisiae)) The peptide sequence was selected from the middle region of RAD9B. Peptide sequence SSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEED. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| cell cycle checkpoint control protein RAD9B, cell cycle checkpoint control protein RAD9B homolog, DNA repair exonuclease rad9 homolog B, FLJ40346, hRAD9B, MGC75426, RAD9 homolog B (S. pombe) | |
| RAD9B | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title