Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RAD9B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen RAD9B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP158205
View Documents
Novus Biologicals
NBP158205
100 μL
Each for $436.00
Add to cart
 
NBP15820520
View Documents
Novus Biologicals
NBP15820520UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

RAD9B Polyclonal specifically detects RAD9B in Human samples. It is validated for Western Blot.
Specifications

Specifications

RAD9B
Polyclonal
Rabbit
Cell Cycle and Replication
Q6WBX8-3
144715
Synthetic peptides corresponding to RAD9B(RAD9 homolog B (S. cerevisiae)) The peptide sequence was selected from the middle region of RAD9B. Peptide sequence SSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEED.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
cell cycle checkpoint control protein RAD9B, cell cycle checkpoint control protein RAD9B homolog, DNA repair exonuclease rad9 homolog B, FLJ40346, hRAD9B, MGC75426, RAD9 homolog B (S. pombe)
RAD9B
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit