Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP174190
Description
RAG1 Polyclonal specifically detects RAG1 in Mouse samples. It is validated for Western Blot, Chromatin Immunoprecipitation.Specifications
RAG1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
MGC43321, RAG-1, recombination activating gene 1, RING finger protein 74, RNF74recombination activating protein 1, V(D)J recombination-activating protein 1 | |
Rabbit | |
119 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot, ChIP Assay | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation (ChIP) | |
P15919 | |
RAG1 | |
Synthetic peptides corresponding to the C terminal of Rag1. Immunizing peptide sequence IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT. | |
Affinity purified | |
RUO | |
5896 | |
Mouse, Rat, Porcine, Equine | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction