Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RAG1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

$152.22 - $493.00

Specifications

Antigen RAG1
Applications Western Blot, ChIP assay
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17419020
View Documents
Novus Biologicals
NBP17419020UL
20 μL
Each for $152.22
Add to cart
 
NBP174190
View Documents
Novus Biologicals
NBP174190
100 μL
Each for $493.00
Add to cart
 
Description

Description

RAG1 Polyclonal specifically detects RAG1 in Mouse samples. It is validated for Western Blot, Chromatin Immunoprecipitation.
Specifications

Specifications

RAG1
Polyclonal
Rabbit
P15919
5896
Synthetic peptides corresponding to the C terminal of Rag1. Immunizing peptide sequence IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot, ChIP assay
Unconjugated
RUO
MGC43321, RAG-1, recombination activating gene 1, RING finger protein 74, RNF74recombination activating protein 1, V(D)J recombination-activating protein 1
RAG1
IgG
Affinity Purified
119 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit