Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAG1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
$152.22 - $493.00
Specifications
| Antigen | RAG1 |
|---|---|
| Applications | Western Blot, ChIP assay |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17419020
|
Novus Biologicals
NBP17419020UL |
20 μL |
Each for $152.22
|
|
NBP174190
|
Novus Biologicals
NBP174190 |
100 μL |
Each for $493.00
|
|
Description
RAG1 Polyclonal specifically detects RAG1 in Mouse samples. It is validated for Western Blot, Chromatin Immunoprecipitation.Specifications
| RAG1 | |
| Polyclonal | |
| Rabbit | |
| P15919 | |
| 5896 | |
| Synthetic peptides corresponding to the C terminal of Rag1. Immunizing peptide sequence IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot, ChIP assay | |
| Unconjugated | |
| RUO | |
| MGC43321, RAG-1, recombination activating gene 1, RING finger protein 74, RNF74recombination activating protein 1, V(D)J recombination-activating protein 1 | |
| RAG1 | |
| IgG | |
| Affinity Purified | |
| 119 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title